SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018307 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018307
Domain Number 1 Region: 122-275
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.83e-53
Family Dual specificity phosphatase-like 0.0000000636
Further Details:      
 
Domain Number 2 Region: 276-453
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.94e-48
Family Dual specificity phosphatase-like 0.0000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018307   Gene: ENSGGOG00000027917   Transcript: ENSGGOT00000023365
Sequence length 554
Comment pep:novel chromosome:gorGor3.1:7:49977579:49990561:1 gene:ENSGGOG00000027917 transcript:ENSGGOT00000023365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVSSECGKKCEPLGCSSTNGDFQGEAGAVVSIVLRMVPRIKSNEGYGCSNRNWKKENT
MHSRDRNIVDGGQALGQGKRKSKGRWSWAAAPWCSPRCSLTSPGVKKMRSSTQQDPRRRD
PQDDVYLDITDRLRFAILYSRPKSATNVHYFSIDNELEYENFSEDFGPLNLAMVYRYCCK
INKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEAAYRILIFGDTPYI
PFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDR
FIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDL
FFADGSTPTDAIVKRFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAW
VRICRPGLVIGPQQQFLVMKQTSLWLEGDYFRQKLKGQENGQYRAAFSKLLSGVDDISIN
GVENQDQQEPNPYSDDDEINGVTQGDRRRALKRRRQSKTSDILLPSPLAVLTSTLCSVVI
WWIVCDYILPILLF
Download sequence
Identical sequences ENSGGOP00000018307 ENSGGOP00000018307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]