SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018359 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018359
Domain Number 1 Region: 15-76
Classification Level Classification E-value
Superfamily POZ domain 1.51e-16
Family Tetramerization domain of potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018359   Gene: ENSGGOG00000023695   Transcript: ENSGGOT00000028407
Sequence length 232
Comment pep:novel chromosome:gorGor3.1:17:7545643:7548436:1 gene:ENSGGOG00000023695 transcript:ENSGGOT00000028407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGAMFRAGTPMPPNLNSQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAE
ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVD
TFRANLFCTDSECLGALRARFGVASGDRAEGSPHFHLEWAPRPVELPEVEYGRLGLQPLW
TGGPGERREVVGTPSFLEEVLRVALEHGFRLDSVFPDPEDLLNSRSLRFVRH
Download sequence
Identical sequences A0A158RFT7 G3RRD5 Q693B1
ENSP00000328352 GO.99724 ENSGGOP00000001665 ENSGGOP00000018359 ENSP00000328352 NP_001002914.1.87134 NP_001002914.1.92137 XP_003810141.1.60992 XP_004058519.1.27298 XP_004058524.1.27298 ENSGGOP00000001665 ENSGGOP00000018359 ENSP00000328352 gi|51036594|ref|NP_001002914.1| 9606.ENSP00000328352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]