SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018403 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018403
Domain Number 1 Region: 468-724
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-61
Family YWTD domain 0.000000943
Further Details:      
 
Domain Number 2 Region: 1382-1639
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-57
Family YWTD domain 0.0000033
Further Details:      
 
Domain Number 3 Region: 770-1026
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-55
Family YWTD domain 0.00000145
Further Details:      
 
Domain Number 4 Region: 1077-1330
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-47
Family YWTD domain 0.00000349
Further Details:      
 
Domain Number 5 Region: 291-331
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000038
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 6 Region: 381-460,716-764
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000013
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 7 Region: 255-293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 8 Region: 170-210
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 9 Region: 95-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 10 Region: 336-372
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 11 Region: 1336-1381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000678
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 12 Region: 131-169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 13 Region: 214-252
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000694
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 14 Region: 1032-1085
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000898
Family EGF-type module 0.011
Further Details:      
 
Domain Number 15 Region: 53-95
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000018403
Domain Number - Region: 1639-1676
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00106
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018403   Gene: ENSGGOG00000001024   Transcript: ENSGGOT00000025292
Sequence length 1932
Comment pep:novel chromosome:gorGor3.1:11:47620030:47668141:-1 gene:ENSGGOG00000001024 transcript:ENSGGOT00000025292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VALGLRAGERTRSGPGSSSPSGGISGGASAGSGLGRGSGLGRGAGLASSPECACGRSHFT
CAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCILPTCSPLDFHCDNGKCIRRSWVCDGD
NDCEDDSDEQDCPPRECEEDEFPCQNGYCIRSLWHCDGDNDCGDNSDEQCDMRKCSDKEF
RCSDGSCIAEHWYCDGDTDCKDGSDEENCPSAVPAPPCNLEEFQCAYGRCILDIYHCDGD
DDCGDWSDESDCSSHQPCRSGEFMCDSGLCINAGWRCDGDADCDDQSDERNCTTSMCTAE
QFRCHSGRCVRLSWRCDGEDDCADNSDEENCENTGSPQCASDQFLCWNGRCIGQRKLCNG
VNDCGDNSDESPQQNCRPRTGEENCNVNNGGCAQKCQMVRGAVQCTCHTGYRLTEDGHTC
QDVNECAEEGYCSQGCTNSEGAFQCWCETGYELRPDRRSCKALGPEPVLLFANRIDIRQV
LPHRSEYTLLLNNLENAIALDFHHRRELVFWSDVTLDRILRANLNGSNVEEVVSTGLESP
GGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLLWQNLEKPRAIALHPMEGTIYWTDW
GNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYWVDAKHHVIERANLDGSHRK
AVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKLHFPMDIHTLHPQ
RQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTGFRKISSHACAQSLDKFLLFARRMDIR
RISFDTEDLSDDVIPLADVRSAVALDWDSRDDHVYWTDVSTDTISRAKWDGTGQEVVVDT
SLESPAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMRTVLIWENLDRPRDIVVEPMGGYM
YWTDWGASPKIERAGMDASGRQVIISSNLTWPNGLAIDYGSQRLYWADAGMKTIEFAGLD
GSKRKVLIGSQLPHPFGLTLYGERIYWTDWQTKSIQSADRLTGLDRETLQENLENLMDIH
VFHRRRPPVSTPCAMENGGCSHLCLRSPNPSGFSCTCPTGINLLSDGKTCSPGMNSFLIF
ARRIDIRMVSLDIPYFADVVVPINITMKNTIAIGVDPQEGKVYWSDSTLHRISRANLDGL
QHADIVTTGLQTTDGLAVDAIGRKVYWTDTGTNRIEVGNLDGSMRKVLVWQNLDSPRAIV
LYHEMGFMYWTDWGENAKLERSGMDGSDRAVLINNNLGWPNGLTVDKASSQLLWADAHTE
RIEAADLNGANRHTLVSPVQHPYGLTLLDSYIYWTDWQTRSIHRADKGTGSNVILVRSNL
PGLMDIQAGDRAQPLGFNKCGSRNGGCSHLCLPRPSGFSCACPTGIQLKGDGKTCDPSPE
TYLLFSSRGSIRRISLDTSDHTDVHVPVPELNNVISLDYDSVDGKVYYTDVFLDVIRRAD
LNGSNMETVIGQGLKTTDGLAVDWVARNLYWTDTGRNTIEASRLDGSCRKVLINNSLDEP
RAIAVFPRKGYLFWTDWGHIAKIERANLDGSERKVLINTDLGWPNGLTLDYDTRRIYWVD
AHLDRIESADLNGKLRQVLVSHVSHPFALTQQDRWIYWTDWQTKSIQRVDKYSGRNKETV
LANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHLCFARALDFVCACPDEPDSRPCSLVPG
LVPPAPRATGMSEKSPVLPNTPPTTLHSSTTRTRTSLEEVEGRCSERDARLGLCARSNEA
VPAAPGEGLHISYAIGGLLSILLILVVIAALMLYRHKKSKFTDPGMGNLTYSNPSYRTST
QEVKIEAIPKPAMYNQLCYKKEGGPDHNYTKEKIKIVEGICLLSGDDAEWDDLKQLRSSR
GGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQSECSSVHTAATPERRGSLPDTGW
KHERKLSSESQV
Download sequence
Identical sequences ENSGGOP00000018403 ENSGGOP00000001011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]