SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018429 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018429
Domain Number 1 Region: 219-340
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-35
Family BCR-homology GTPase activation domain (BH-domain) 0.00035
Further Details:      
 
Domain Number 2 Region: 32-164
Classification Level Classification E-value
Superfamily PH domain-like 3.61e-20
Family Pleckstrin-homology domain (PH domain) 0.0000613
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018429   Gene: ENSGGOG00000027449   Transcript: ENSGGOT00000026885
Sequence length 340
Comment pep:novel chromosome:gorGor3.1:16:34192032:34221232:-1 gene:ENSGGOG00000027449 transcript:ENSGGOT00000026885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLDSWGTSEDADAPSKQHSTSDLSDTTFSDIRREGWLYYKQNLTKKGKKAGSGLRQWKRV
YAALRARSLSLSKERQEPGPAAAGAAEAGAGEHEAAPVCIGSCLVDISYSETKRRHVFRL
TTADFCEYLFQAEDWDDMLGIRAIWENSRAEGEDPSCANQALISKMLNDYHKVSHSSGPK
ADSSPKGSCGLGGLKSEFLKQREARGLRTQDLPAGSKCWQDLKVISSLLKSFFRKLPEPL
FTDDKYNDFIEANRIEDVWERMRTLRKLIRDLPGHYYETLKFLVGHLKTIADHSEKNKIE
PRNLALVFGPTMVRTSEDNMTDMVTHMPDCYKIVETLIQH
Download sequence
Identical sequences ENSGGOP00000018429 ENSGGOP00000018429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]