SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018519 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018519
Domain Number 1 Region: 290-576
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.75e-86
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000794
Further Details:      
 
Domain Number 2 Region: 87-262
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.71e-35
Family CRAL/TRIO domain 0.0004
Further Details:      
 
Domain Number 3 Region: 3-82
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0000000000000392
Family CRAL/TRIO N-terminal domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018519   Gene: ENSGGOG00000015744   Transcript: ENSGGOT00000025295
Sequence length 593
Comment pep:novel chromosome:gorGor3.1:15:55085192:55142379:-1 gene:ENSGGOG00000015744 transcript:ENSGGOT00000025295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPATAPRPDMAPELTPEEEQATKQFLEEINKWTVQYNVSPLSWNVAVKFLMARKFDVLR
AIELFHSYRETRRKEGIVKLKPHEEPLRSEILSGKFTILNVRDPTGASIALFTARLHHPH
KSVQHVVLQALFYLLDRAVDSFETQRNGLVFIYDMCGSNYANFELDLGKKVLNLLKGAFP
ARLKKVLIVGAPIWFRVPYSIISLLLKDKVRERIQILKTSEVTQHLPRECLPENLGGYVK
IDLATWNFQFLPQVNGHPDPFDEIILFSLPPALDWDSVHVPGPHAMTIQELVDYVNARQK
QGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQTDYINA
SFMDGYKQKNAYIGTQGKLVRPSHGYCCGEERWKAYLALCVFSFEEGGRRKCGQYWPLEK
DSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASL
IDFLRVVRNQQSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGT
LNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEGMVSSGQNLLAVESQ
Download sequence
Identical sequences ENSGGOP00000015362 ENSGGOP00000018519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]