SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018814 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018814
Domain Number 1 Region: 12-251
Classification Level Classification E-value
Superfamily L domain-like 6.12e-25
Family Internalin LRR domain 0.022
Further Details:      
 
Domain Number 2 Region: 298-383
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.67e-16
Family Ubiquitin-related 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018814   Gene: ENSGGOG00000024606   Transcript: ENSGGOT00000023880
Sequence length 385
Comment pep:novel chromosome:gorGor3.1:11:119014591:119054343:1 gene:ENSGGOG00000024606 transcript:ENSGGOT00000023880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSHHSDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNV
PQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHTILQELPDLEELFLC
LNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPD
DSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIA
RLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLR
PQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEM
KYSSRALHSFGIRDGDKIYVESKTK
Download sequence
Identical sequences ENSGGOP00000018814 ENSGGOP00000018814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]