SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018931 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018931
Domain Number 1 Region: 13-256
Classification Level Classification E-value
Superfamily HAD-like 2.39e-65
Family Predicted hydrolases Cof 0.000000000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018931   Gene: ENSGGOG00000025969   Transcript: ENSGGOT00000032883
Sequence length 264
Comment pep:novel chromosome:gorGor3.1:22:25934326:25947433:-1 gene:ENSGGOG00000025969 transcript:ENSGGOT00000032883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQ
LGDGDEGDPEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMAL
LRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKG
LRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGH
SVVSPQDTVQRCREIFFPETAHEA
Download sequence
Identical sequences ENSGGOP00000018931 ENSGGOP00000018931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]