SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018989 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018989
Domain Number 1 Region: 8-129
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000184
Family Ngr ectodomain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018989   Gene: ENSGGOG00000028001   Transcript: ENSGGOT00000024021
Sequence length 200
Comment pep:novel chromosome:gorGor3.1:11:72265700:72266378:1 gene:ENSGGOG00000028001 transcript:ENSGGOT00000024021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PALLAALDAALAPLTELRLLGLAGNALSRLPPAALRLARLEQLDVRLNALAGLDPDELRA
LERDGGLPGPRLLLADNPLRCGCAARPLLAWLRNATERVPDSRRLRCAAPRALLDRPLLD
LDGARLRCADSGADARGEEAEAAGXQTRRGIQRWMRNLREACRDQMEGYHYRYEQDADPR
RAPAPAAPAGSRATSPGSGL
Download sequence
Identical sequences ENSGGOP00000018989 ENSGGOP00000018989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]