SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018991 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018991
Domain Number 1 Region: 237-427
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.12e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.000000012
Further Details:      
 
Domain Number 2 Region: 64-204
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.49e-24
Family CRAL/TRIO domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018991   Gene: ENSGGOG00000005697   Transcript: ENSGGOT00000022783
Sequence length 452
Comment pep:novel chromosome:gorGor3.1:11:47435376:47459606:-1 gene:ENSGGOG00000005697 transcript:ENSGGOT00000022783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLSELQDDPTLDDTSEALNQLKLSSIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKW
DDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDY
TLLYLHHGLTSDNKPSLSWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPLISF
KFGQKIFYVNYLSELSEHVKLEQLGIPRQVLKYDDFLKSTQKSPATAPKPMPPRPPLPNQ
QFGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGIFRRSANTQVVREVQQKYNMG
LPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVPETLQVLQTL
PEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFF
FFFFLRWSLALSPGWSAVARWVQAILLPQPPE
Download sequence
Identical sequences ENSGGOP00000018991 ENSGGOP00000005580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]