SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019114 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019114
Domain Number 1 Region: 237-313
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000000872
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Domain Number 2 Region: 14-45
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000889
Family Intermediate filament protein, coiled coil region 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019114   Gene: ENSGGOG00000023599   Transcript: ENSGGOT00000033735
Sequence length 358
Comment pep:novel chromosome:gorGor3.1:21:8777356:8778446:-1 gene:ENSGGOG00000023599 transcript:ENSGGOT00000033735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGVLAGMGGIQNAETMQSVNNWLASYLDRVRSLETENWKLESKIREPLEKKGPQVRDWG
HYFKTIEDLSVHIFANTVDSSCIVLQIDNARIAANDFRVTYESELAMHQSVESNIHGLHK
IADDTNVTQLQLETEMEALKDELLFMKKNHEEEVKGLQAQIASSGLTVEVDALKLQDLTK
IMADIQAQYDELAWKNREELDKLIEESTTVVTTQFIEVGAAEMILMEMRHTVQSLEIDLD
SMRNLKASLENSLKEVEARYALQMEQLNRTLMHLESELPQTWAEGQHQAQEGGAAEHKVK
LEAEIATYHPLLEDGEDFNLGNALDSSNSMQTIQKTATCQTVDGKVVSGTNDTEVLRH
Download sequence
Identical sequences ENSGGOP00000019114 ENSGGOP00000019114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]