SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019616 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019616
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily L domain-like 1.29e-53
Family Ngr ectodomain-like 0.0055
Further Details:      
 
Domain Number 2 Region: 180-427
Classification Level Classification E-value
Superfamily L domain-like 5.44e-35
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 3 Region: 483-773
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 8.97e-35
Family Rhodopsin-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019616   Gene: ENSGGOG00000026819   Transcript: ENSGGOT00000026702
Sequence length 894
Comment pep:novel chromosome:gorGor3.1:11:27746357:27775117:-1 gene:ENSGGOG00000026819 transcript:ENSGGOT00000026702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTFSRDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQL
KTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLP
TLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIKSLSQHCFDGLDNLETLDLNYNNL
GEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSD
LHSLVIRGASMVQQFPNLTGTVHLESLTLTGAKISSIPNNLCQEQKMLRTLDLSYNNIRD
LPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITN
LDVSFNELTSFPTEGLNGLNQLKLVGNLKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCD
SYANLNTEDNSLQDHSVAQEKGTADAANVTSTVENEEHRQIIIHCTPSTGAFKPCEYLLG
SWMIRLTVWFIFLVALFFNLLVILTTFASCTSLPSSKLFIGLISVSNLFMGIYTGILTFL
DAVSWGRFAEFGIWWETGSGCKVAGFLAVFSSESAIFLLMLATVERSLSAKDIMKNGKSN
HLKQFRVAALLAFLGATVAGCFPLFHRGEYSASPLCLPFPTGETPSLGFTVTLVLLNSLA
FLLMAIIYTKLYCNLEKEDLSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAISI
SPEIMKSVTLIFFPLPACLNPVLYVFFNPKFKEDWKLLKRRVTKKSGSVSVSISSQGGCL
EQDFYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWS
DCGTQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD
Download sequence
Identical sequences ENSGGOP00000025004 ENSGGOP00000019616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]