SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019904 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019904
Domain Number 1 Region: 328-585
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.56e-99
Family STAT DNA-binding domain 0.0000603
Further Details:      
 
Domain Number 2 Region: 137-333
Classification Level Classification E-value
Superfamily STAT 1.8e-54
Family STAT 0.00019
Further Details:      
 
Domain Number 3 Region: 2-125
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 2.22e-39
Family Transcription factor STAT-4 N-domain 0.0004
Further Details:      
 
Domain Number 4 Region: 586-708
Classification Level Classification E-value
Superfamily SH2 domain 8.48e-34
Family SH2 domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019904   Gene: ENSGGOG00000008216   Transcript: ENSGGOT00000025365
Sequence length 788
Comment pep:novel chromosome:gorGor3.1:5:41820278:41910658:1 gene:ENSGGOG00000008216 transcript:ENSGGOT00000025365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQ
LLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRL
VREANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQES
LRIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQL
LRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHL
CQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGK
LNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNM
SLKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNAT
ATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFN
NSSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVN
KQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADR
LGDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAG
GGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDS
QWIPHAQS
Download sequence
Identical sequences ENSGGOP00000019904 ENSGGOP00000019904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]