SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020061 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020061
Domain Number 1 Region: 149-255
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000581
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 258-381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000439
Family Growth factor receptor domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020061
Domain Number - Region: 40-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0013
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020061   Gene: ENSGGOG00000022559   Transcript: ENSGGOT00000028155
Sequence length 495
Comment pep:novel chromosome:gorGor3.1:2a:56917568:56976263:-1 gene:ENSGGOG00000022559 transcript:ENSGGOT00000028155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMK
CVNHYGGYLCLPKTAQIIVNNEQPQQETQPAEGTSGATTGVVAASSMATSGVLPGGGFVA
SAAAVAGPEMQTGRNNFVIRRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAG
THNCRADQVCINLRGSFACQCPPGYQKRGDQCVDIDECTIPPYCHQRCVNTPGSFYCQCS
PGFQLAANNYTCVVSDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDEC
RTSSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMCWNYHGGFR
CYPRNPCQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSIRSDRSVPSDIFQIQATTI
YANTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRT
SSVLRLTIIVGPFSF
Download sequence
Identical sequences ENSGGOP00000020061 ENSGGOP00000020061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]