SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020184 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020184
Domain Number 1 Region: 18-212
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020184   Gene: ENSGGOG00000025007   Transcript: ENSGGOT00000030544
Sequence length 805
Comment pep:novel chromosome:gorGor3.1:5:121452586:121531841:-1 gene:ENSGGOG00000025007 transcript:ENSGGOT00000030544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKSSSPSLSNCNSVLANKIFGIPLDELQQGGHPDNEVPFIVRHVVDYIEEHGGLEQQGL
FQVNGNAETVEWLRQRYDSGEEVDLVKEADVPSAISLLRFFLQELPEPVIPGSLHIHLMQ
LSQDYNNEDEFGRKLRFLLQQLPPVNYSLLKFLCRFLANVASHHEEIWSANSLAAVFGPD
VFHIYTDVEDMKEQEIVSRIMAGLLENYYDFFENEEEDFSSNDLSSITEQVNELSEEEEE
DEKLEHIEELPEEGAEKSNDMPEVVQLRMTENILESNSVTATTSVGILLEPCSDHCDSED
GCLEREEYLLFDSDKLSHLILDSSSKICDLNANTESEVPGGQSVGVQGEAACVSIPHLDL
KNVSDGDKWEEPFPAFKSWQEDSESGEAQLSPQAGRMNHHPLEEDCPPVLSHRSLDFGQS
QRFLHDPEKLDSSSKALSFTRIRRSSFSSKDEKREDRTPYQLVKKLQKKIRQFEEQFERE
RNSKPSYSDIAANPKVLKWMTELTKLRKQIKDAKHKNSDGEFVPQTRPRSNTLPKSFGSS
LDHEDEENEDEPKVIQKEKKPSKEATLELILKRLKEKRIERCLPEDIKKMTKDHLVEEKA
SLQKSLLYYESQHGRPVTKEERHIVKPLYDRYRLVKQMLTRASITPVLGSPSTKRRGQML
QPIIEGETAHFFEEIKEEEEDGVNLSSELGDILKTAVQVQSSLENSESDVEENQEKLALD
LRLSSSRAASMPELLEQLWKARAEKKKLRKTLREFEEAFYQQNGRNAQKEDRVPVLEEYR
EYKKIKAKLRLLEVLISKQDSSKSI
Download sequence
Identical sequences ENSGGOP00000020184 ENSGGOP00000020184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]