SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020303 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020303
Domain Number 1 Region: 7-154
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.03e-54
Family Dual specificity phosphatase-like 0.00000239
Further Details:      
 
Domain Number 2 Region: 180-327
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.44e-42
Family Dual specificity phosphatase-like 0.00000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020303   Gene: ENSGGOG00000006770   Transcript: ENSGGOT00000027927
Sequence length 623
Comment pep:novel chromosome:gorGor3.1:1:103071093:103218632:1 gene:ENSGGOG00000006770 transcript:ENSGGOT00000027927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAESGELIGACEFMKDRLYFATLRNRPKSTVNTHYFSIDEELVYENFYADFGPLNLAMV
YRYCCKLNKKLKSYSLSRKKIVHYTCFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLS
GSNPPYLPFRDASFGNCTYNLTILDCLQGIRKVITILLAVVDTFFSFLTKFCQRVENGDF
NWIVPGKFLAFSGPHPKSKIENGYPFHAPEAYFPYFKKHNVTAVVRLNKKIYEAKRFTDA
GFEHYDLFFIDGSTPSDNIVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFT
HAEIIAWIRICRPGSIIGPQQHFLEEKQTSLWVQGDIFRSKLKNRPSSEGSINKILSGLD
DMSIGGNLSKTQNMERFGEDNLEDDDVEMKNGITQGDKLRALKSQRQPRTSPSCAFRSDD
TKGHPRAVSQPFRLSSSLQGSAVTLKTSKMALSPSATAKRINRTSLSSGATVRSFSINSR
LASSLGNLNAATDDPENKKTSSSSKAGFTASPFTNLLNGSSQPTTRNYPELNNNQYNRSS
NSNGGNLNSPPGPHSAKTEEHTTILRPSYTGLSSSSARFLSRSIPVSSQTPPPGPQNPEC
NFCALPSQPRLPPKKFNSAKEAF
Download sequence
Identical sequences ENSGGOP00000020303 ENSGGOP00000006627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]