SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020305 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020305
Domain Number 1 Region: 279-333
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000575
Family Intermediate filament protein, coiled coil region 0.0061
Further Details:      
 
Domain Number 2 Region: 54-88
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000011
Family Intermediate filament protein, coiled coil region 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020305   Gene: ENSGGOG00000026038   Transcript: ENSGGOT00000026666
Sequence length 333
Comment pep:novel chromosome:gorGor3.1:18:9816715:9817730:-1 gene:ENSGGOG00000026038 transcript:ENSGGOT00000026666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSGLRPGTTSVYAGAGGSGSRISMSHSSSFWGGMGSGGLAAGMAGGLAGMGGIQNEKENL
QSLNNCLASYLDGVRSLETKNRRLESKIWEHLERDPRSRDWSRYFKTIEDLRAQIFANTV
DNACIVLQIDNARLAVDDFRVKYETELAMRQSVKSDIHGLRKVINDTNVTWLQLETEIEA
LKEELLFMKKNREEEVKGLQAQTARSGLTVEVDAPKSQDFAKIMADIWAQYDKLRRTERS
WTSTGLSRLRRAPQWSQRRLPRDDTTLTELRRTVQSLEIDLDSMRNLKASLENSLREVEA
RYTLQMKQLNGILLHLESELAQTWAEGQRQAQE
Download sequence
Identical sequences ENSGGOP00000020305 ENSGGOP00000020305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]