SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020414 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020414
Domain Number 1 Region: 66-231
Classification Level Classification E-value
Superfamily RUN domain-like 8.24e-54
Family RUN domain 0.000000026
Further Details:      
 
Domain Number 2 Region: 523-611
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000283
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020414
Domain Number - Region: 271-318
Classification Level Classification E-value
Superfamily Prefoldin 0.00165
Family Prefoldin 0.016
Further Details:      
 
Domain Number - Region: 278-501
Classification Level Classification E-value
Superfamily Tropomyosin 0.0216
Family Tropomyosin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020414   Gene: ENSGGOG00000026311   Transcript: ENSGGOT00000029696
Sequence length 620
Comment pep:novel chromosome:gorGor3.1:4:79195446:79281798:1 gene:ENSGGOG00000026311 transcript:ENSGGOT00000029696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHED
PNYLMANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKK
TFLGQNKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYM
KALINKKELLSEFYEPNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDSQVGVIDFSM
YLKDGNSSKGTEGDGQITAILDQKNYVEELNRHLNATVNNLQAKVDALEKSNTKLTEELA
VANNRIITLQEEMERVKEESSYILESNRKGPKQDRTAEGQALSEARKHLKEETQLRLDVE
KELEMQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVK
QKSELNSRLEEKTNQMAATIKQLEQRLRQAERSRQSAELDNRLFKQDFGDKINSLQLEVE
ELTRQRNQLELELKQEKERRLQNDRSIPGRGSQKSESKMDGKHKMQEENVKLKKPLEESH
RLQPHPMDEQDQLLLSEKPQVCQLCQEDGSLAKNVCKNCRGTFCDACSTNELPVPSSIKL
ERVCNPCHKHLMKQYSTSPS
Download sequence
Identical sequences G3RX78
ENSGGOP00000020414 ENSGGOP00000020414 XP_004038834.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]