SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020486 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020486
Domain Number 1 Region: 175-421
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 3.92e-81
Family Oxidoreductase molybdopterin-binding domain 0.00000000966
Further Details:      
 
Domain Number 2 Region: 424-545
Classification Level Classification E-value
Superfamily E set domains 3.85e-39
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.00000552
Further Details:      
 
Domain Number 3 Region: 85-167
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 4.84e-21
Family Cytochrome b5 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020486   Gene: ENSGGOG00000023990   Transcript: ENSGGOT00000027619
Sequence length 547
Comment pep:novel chromosome:gorGor3.1:12:54081239:54084050:1 gene:ENSGGOG00000023990 transcript:ENSGGOT00000027619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATMLLLHRAVVLRLQQACRLKSVPSRICIQACSTNDSFQPQRPSLTFSGDNSSTQGWRVM
GTLLGLGAVLAYQDHRCRAAQESTHIYTKEEVSSHTSPETGIWVTLGSEVFDVTEFVDLH
PGGPSKLMLAAGGPLEPFWALYAVHNQSHVRELLAQYKIGELNPEDKVAPTVETSDPYAD
DPVRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVGAP
GGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARL
CDVLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLP
RDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWDTVDFDSAP
SIQELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGE
EQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHR
VHVYVSP
Download sequence
Identical sequences ENSGGOP00000023301 ENSGGOP00000020486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]