SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020501 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020501
Domain Number 1 Region: 112-495
Classification Level Classification E-value
Superfamily L domain-like 3.91e-53
Family Ngr ectodomain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 407-633
Classification Level Classification E-value
Superfamily L domain-like 6.8e-42
Family Ngr ectodomain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020501   Gene: ENSGGOG00000005637   Transcript: ENSGGOT00000026845
Sequence length 662
Comment pep:novel chromosome:gorGor3.1:1:54749768:54773127:1 gene:ENSGGOG00000005637 transcript:ENSGGOT00000026845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGARARGAQLRLGERVRPVGLRSAPGRSRFRQPWRPGASDSAPPAGTMAQSRVLLLLLL
LPPQLHLGPVLAVRAPGFGRSGGHSLSPEENEFAEEEPVLVLSPEEPGPGPAAVSCPRDC
ACSQEGVVDCGGIDLREFPGDLPEHTNHLSLQNNQLEKIYPEELSRLHRLETLNLQNNRL
TSRGLPEKAFEHLTNLNYLYLANNKLTLAPRFLPNALISVDFAANYLTKIYGLTFGQKPN
LRSVYLHNNKLADAGLPDNMFNGSSNVEVLILSSNFLRHVPKHLPPALYKLHLKNNKLEK
IPPGAFSELSSLRELYLQNNYLTDEGLDNETFWKLSSLEYLDLSSNNLSRVPAGLPRSLV
LLHLEKNAIRSVDADVLTPIRSLEYLLLHSNQLRAQGIHPLAFQGLKRLHTVHLYNNALE
RVPSGLPRRVRTLMILHNQITGIGREDFATTYFLEELNLSYNRITSPQVHRDAFRKLRLL
RSLDLSGNRLHTLPPGLPRNVHVLKVKRNELAALARGALAGMAQLRELYLTSNRLRSRAL
GPRAWVDLAHLQLLDIAGNQLTEIPEGLPESLEYLYLQNNKISAVPANAFNSTPNLKGIF
LRFNKLAVGSVVDSAFRRLKHLQVLDIEGNLEFGDVSKDRGRLGKEKEEEEEEEEEEEET
RQ
Download sequence
Identical sequences G3QS91
XP_004025860.1.27298 ENSGGOP00000005521 ENSGGOP00000020501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]