SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020511 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020511
Domain Number 1 Region: 235-310
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.09e-19
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 2 Region: 13-44
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000314
Family Intermediate filament protein, coiled coil region 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020511   Gene: ENSGGOG00000023663   Transcript: ENSGGOT00000026875
Sequence length 315
Comment pep:novel chromosome:gorGor3.1:X:126124496:126125457:1 gene:ENSGGOG00000023663 transcript:ENSGGOT00000026875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMAKGLVGMGGIHNDKETMQDLNNHLASYLDRVRGLESENQKQESKIWDHLVTDWGHYFK
TLEDLKAQIFANSVDNTHVILQTDNAHLAVDDFRVKYDIELAMHESVESDIHGLRKLTDD
TSVTWLQLETEIEALKEELLFMKNHEEEVKGLKAQITSSGLTMELNAPKSQDLCKITDTW
AQYDKLAQKNPEELDMYWSQQIEESTTVVTKQAAEIGVAEMILTELRHTVQSLEINLDSM
RNLKASLENSLREAEAHYTMQMKQLSGVLLHLESELAQTRAEGQHQAQEYEALLNIKVKL
EAEITTYHYLGEEGR
Download sequence
Identical sequences ENSGGOP00000020511 ENSGGOP00000020511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]