SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020672 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020672
Domain Number 1 Region: 204-528
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-81
Family p120GAP domain-like 0.0001
Further Details:      
 
Domain Number 2 Region: 488-625
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-42
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 
Domain Number 3 Region: 56-216
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.06e-26
Family Synaptotagmin-like (S variant) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020672
Domain Number - Region: 1-42
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0154
Family PLC-like (P variant) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020672   Gene: ENSGGOG00000023738   Transcript: ENSGGOT00000025945
Sequence length 733
Comment pep:novel chromosome:gorGor3.1:3:141764405:141860690:1 gene:ENSGGOG00000023738 transcript:ENSGGOT00000025945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGKVAIKKEDLCNHSGKETWFSLQPVDSNSEVQGKVHLELKLNELITENGTVCQQLVVHI
KACHGLPLINGQSCDPYATVSLMGPSRNDQKKTKVKKKTSNPQFNEIFYFEVTRSSSYTR
KSQFQVEEEDIEKLEIRIDLWNNGNLVQDVFLGEIKVPVNVLRTDSSHQAWYLLQPRDNG
NKSSKTDDLGSLRLNICYTEDYVLPSEYYGPLKTLLLKSPDVQPISASAAYILSEICRDK
NDAVLPLVRLLLHHDKLVPFATAVAELDLKDTQDANTIFRGNSLATRCLDEMMKIVGGHY
LKVTLKPILDEICDSSKSCEIDPIKLKEGDNVENNKENLRYYVDKLFNTIVKSSMSCPTV
MCDIFYSLRQMATQRFPNDPHVQYSAVSSFVFLRFFAVAVVSPHTFHLRPHHPDAQTIRT
LTLISKTIQTLGSWGSLSKSKSSFKETFMCEFFKMFQEEGYIIAVKKFLDEISSTETKES
SGTSEPVHLKEGEMYKRAQGRTRIGKKNFKKRWFCLTSRELTYHKQPGSKDAIYTIPVKN
ILAVEKLEESSFNKKNMFQVIHTEKPLYVQANNCVEANEWIDVLCRVSRCNQNRLSFYHP
SVYLNGNWLCCQETGENTLGCKPCTAGVPADIQIDIDEDRETERIYSLFTLSLLKLQKME
EACGTIAVYQGPQKEPDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAK
YGSKENPIVGKAS
Download sequence
Identical sequences ENSGGOP00000020672 ENSGGOP00000020672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]