SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020706 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020706
Domain Number 1 Region: 294-620
Classification Level Classification E-value
Superfamily L domain-like 2.38e-38
Family Internalin LRR domain 0.088
Further Details:      
 
Domain Number 2 Region: 670-816
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.35e-37
Family Toll/Interleukin receptor TIR domain 0.0000455
Further Details:      
 
Domain Number 3 Region: 32-253
Classification Level Classification E-value
Superfamily L domain-like 1.16e-33
Family Ngr ectodomain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020706   Gene: ENSGGOG00000025289   Transcript: ENSGGOT00000023147
Sequence length 839
Comment pep:known chromosome:gorGor3.1:9:100364814:100377034:1 gene:ENSGGOG00000025289 transcript:ENSGGOT00000023147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLD
LSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALG
AFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEYL
DLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMTFIQPGAFKEIRLHKLTLRNNFDSL
NVMKTCIQGLAGLEVRRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDI
IDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTS
NKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLG
LEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAG
NSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPY
KCLNSLRVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQL
LVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLML
LAGCIKYGRGENVYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAA
NIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLR
QQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI
Download sequence
Identical sequences B3Y629 G3RY19
ENSGGOP00000020706 ENSGGOP00000021036 NP_001266512.1.27298 XP_004048562.1.27298 ENSGGOP00000020706 ENSGGOP00000021036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]