SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020993 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020993
Domain Number 1 Region: 49-227
Classification Level Classification E-value
Superfamily L domain-like 1.19e-33
Family Ngr ectodomain-like 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020993
Domain Number - Region: 301-379
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00204
Family Fibronectin type III 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020993   Gene: ENSGGOG00000017070   Transcript: ENSGGOT00000017127
Sequence length 820
Comment pep:novel chromosome:gorGor3.1:22:21688249:21747817:-1 gene:ENSGGOG00000017070 transcript:ENSGGOT00000017127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLGLCAAALLCVCRPGAVRADCWLIEGDKGYVWLAICSQNQPPYETIPQHINSTVHDL
RLNENKLKAVLYSSLNRFGNLTDLNLTKNEISYIEDGAFLGQSSLQVLQLGYNKLSNLTE
GMLRGMSRLQFLFVQHNLIEVVTPTAFSECPSLISIDLSSNRLSRLDGATFASLASLMVC
ELAGNPFNCECDLFGFLAWLVVFNNVTKNYDRLQCESPREFAGYPLLVPRPYHSLNAITV
LQAKCRNGSLPARPVSHPTPYSTDAQREPDENSGFNPDEILSVEPPASSTTDASAGPAIK
LHHVTFTSATLVVIIPHPYSKMYILVQYNNSYFSDVMTLKNKKEIVTLDKLRAHTEYTFC
VTSLRNSRRFNHTCLTFTTRDPIPGDLAPSTSTTTHYIMTILGCLFGMVIVLGAVYYCLR
KRRMQEEKQKSVNVKKTILEMRYGADVDAGSIVHAAQKLGEPPVLPVSRMASIPSMIGEK
LPTAKGLEAGLDTPKVATKGNYIEVRTGAGGDGLARPEDDLPDLENGQGSAAEISTIAKE
VDKVNQIINNCIDALKLDSASFLGGGSSSGDPELAFECQSLPAAAAASSATGPGALERPS
FLSPPYKESSHHPLQRQLSADAAVTRKTCSVSSSGSIKSAKVFSLDVPDHPAATGLAKGD
SKYIEKGSPLNSPLDRLPLVPAGSGGGSGGGGGIHHLEVKPAYHCSEHRHSFPALYYEEG
ADSLSQRVSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPYKKHH
REEVYMAAGHALRKKVQFAKDEDLHDILDYWKGVSAQQKL
Download sequence
Identical sequences A0A2I2Z297
ENSGGOP00000020993 ENSGGOP00000020993 XP_004063481.1.27298 XP_018874174.1.27298 XP_018874175.1.27298 XP_018874176.1.27298 XP_018874177.1.27298 XP_018874178.1.27298 XP_018874179.1.27298 XP_018874180.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]