SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021258 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021258
Domain Number 1 Region: 616-802
Classification Level Classification E-value
Superfamily vWA-like 2.5e-53
Family Integrin A (or I) domain 0.00056
Further Details:      
 
Domain Number 2 Region: 799-993
Classification Level Classification E-value
Superfamily vWA-like 2.08e-50
Family Integrin A (or I) domain 0.00043
Further Details:      
 
Domain Number 3 Region: 433-618
Classification Level Classification E-value
Superfamily vWA-like 8.77e-50
Family Integrin A (or I) domain 0.00049
Further Details:      
 
Domain Number 4 Region: 25-207
Classification Level Classification E-value
Superfamily vWA-like 1.27e-42
Family Integrin A (or I) domain 0.0011
Further Details:      
 
Domain Number 5 Region: 221-416
Classification Level Classification E-value
Superfamily vWA-like 1.91e-39
Family Integrin A (or I) domain 0.0029
Further Details:      
 
Domain Number 6 Region: 991-1184
Classification Level Classification E-value
Superfamily vWA-like 3.34e-38
Family Integrin A (or I) domain 0.001
Further Details:      
 
Domain Number 7 Region: 2286-2497
Classification Level Classification E-value
Superfamily vWA-like 9.94e-36
Family Integrin A (or I) domain 0.0052
Further Details:      
 
Domain Number 8 Region: 1956-2167
Classification Level Classification E-value
Superfamily vWA-like 5.25e-31
Family Integrin A (or I) domain 0.0054
Further Details:      
 
Domain Number 9 Region: 1752-1905
Classification Level Classification E-value
Superfamily vWA-like 1.95e-28
Family Integrin A (or I) domain 0.0058
Further Details:      
 
Domain Number 10 Region: 1190-1385
Classification Level Classification E-value
Superfamily vWA-like 0.000000000238
Family RoRNP C-terminal domain-like 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021258   Gene: ENSGGOG00000006695   Transcript: ENSGGOT00000024941
Sequence length 2613
Comment pep:novel chromosome:gorGor3.1:3:130351038:130491429:1 gene:ENSGGOG00000006695 transcript:ENSGGOT00000024941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKILLIIFVLIIWTETLADQSPGPGPVYADVVFLVDSSDHLGPKSFPFVKTFINKMINSL
PIEANKYRVGLAQYSDEFHSEFHLSTFKGRSPMLNHLKNFQFIGGSLQIGKALQEAHRTY
FSASINGRDRKHFPPILVVLASAESEDEVEEASKALQKDGVKIISVGVQEASEENLKAMA
TSHFHFNLRTIRDLSTFSQNMTQIIKDVTKYKEGAVDADMQVHFPISCQKDSLADLVFLV
DESLGTGGNLRHLQTFLENITSSMDVKENCMRLGLMSYSDSAKTISFLKSSTTQSEFQQQ
IKNLSIQVGKSNTGAAIDQMRRDSFSESYGSRRAQGVPQIAVLVTHRPSDDEVHDAALNL
RLEDVNVFALSIQGANNTQLEEIVSYPPEQTISMLKSYADLETYSTKFLKKLQNEIWSQI
STYAEQRDLDKTGCVDTKEADIHFLIDGSSSIQEKQFEQIKRFMLEVTEMFSIGPDKVRV
GVVQYSDDTEVEFYITDYSNDIDLRKAIFNIKQLTGGTYTGKALDYILQIIKNGMNDRMS
KVPCYLIVLTDGMSADRVVEPAKRLRAEQITVHAVGIGAANKIELQEIAGKEERVSFGQN
FDALKSIKNEVVREICAEKGCEDMKADIMFLVDSSWSIGNENFRKMKIFMKNLLTKIQIG
ADKTQIGVVQFSDKTKEEFQLNRYFTQQEISDAIDRMSLINEGTLTGKALNFVGQYFTHS
KGARLGAKKFLILITDGVAQDDVRDPARILRGKDVTIFSVGVYNANRSQLEEISGDSSLV
FHVENFDHLKALERKLIFRVCALHDCKRITLLDVVFVLDHSGSIKKQYQDHMINLTIHLV
KKADVGRGRVQFGALKYSDQPNILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKALKHAN
ALFTEEHGSRIKQNVKQILIVITDGESHDHDQLNDTALELRDKGITIFAVGVGKANQKEL
EGMAGNKNNTIYVDNFDKLKDVFTLVQERMCTEAPEVCHLQEADVIFLCDGSDRVSNSDF
VTMTTFLSDLIDNFDIQSQRMKIGMAQFGSNYRSIIELKNSLTKTQWKTQIQNVSRSGGF
PRIDFALKKVSNMFNLHAGGRRNAGVPQTLVVITSGDPRYDVADAVKTLKDLGICVLVLG
IGDVYKEQLLPITGNSEKIITFQDFDKLKNVDVKKRIIREICQSCGKTNCFMDIVVGFDI
STHVQEQPLFQGHPQLESYLPGILEDISSIRGVSCGAGTEAQVSLAFKVNSDQGFPAKFQ
IYQKAVFDSLLQVNISGPTHLNAQFLRSLWDTFKDKSASRGQVLLIFSDGLQSESNIMLE
NQSDRLREAGLDALLVVSLNTTAHHEFSSFEFGKGFNYRTHLTIGMRELGKTLSQYLGNI
AERTCCCTFCKCPGIPGPHGTRGLQAMKGSQGPKGSRGHRGEDGNPGVRGDTGPQGDKGI
AGCPGAWGQKGLKGFSGPKGGHGDDGIDGLDGEEGSHGFPGIKGEKGDPGSQGSPGSRGA
PGQYGEKGFPGDPGNPGQNNNIKGQKGSKGEQGRQGRTGQKGVQGSPSSRGSRGREGQRG
LRGVSGEPGNPGPTGTLGAEGLQGPQGSQGNPGRKGEKGSQGHKGPQGSPGLMGAKGSTG
RPGLLGKKGEPGLPGDLGPVGQTGQRGRQGDSGISGYGQMGRKGVKGPRGFPGDVGQKGD
IGDPGIPGGPGPKGFRGLALTVGLKGEEGSQGLPGPPGQRGIKGMAGQPVYSQCDLIRFL
REHSPCWKEKCPAYPTELVFALDNSYDVTEESFNKTRDIITSIVNDLNIRENNCPVGARV
AMVSYNSGTSYLIRWSDYNRKKQLLQQLSQIKYQNTTEPRDVGNAMRFVTRNVFKRTYAG
ANVRRVAVFFSNGQTASRSSIITATMEFSALDISPTVFAFDERVFLEAFGFDNTGTFQVI
PVPPDGENQTLERLRRCTLCYDKCFPNACIREAFLPEDSYMDVAFLIDNSRNIAKDEFKA
VKALVSSVIDNFNIASDPLISDSGDRIALLSYSPWESSRRKMGTVKTEFDFITYNNQLLM
KNHIQTSFQQLNGEATIGRALLWTTEHLFPETPYLRKHKVIFVVSTGENYERKEFVKMMA
LRAKCQGYVIFVISLGSTRKDDMEELASYPLDQHLIQLGRIHKPDLNYIAKFLKPFLYSV
RRGFNQYPPPMLEDACRLISLGENIQNDGFQFVTELQEEYLGENGFIGQELNSGRESPFV
KIEDNGSDYLVYLPSQMFEPQKLMINYEKDQKSAEIASLTSGHENYGRKEEPDHTYEPGD
VSLQEYYMDVAFLIDASQRVESDEFKEVKAFITSVLDYFHIAPAPLTSTLGDRVAVLSYS
PPGYMPNTEECPVYLEFDLVTYNSIHQMKHHLQDSQQLNGDVFIGHALQWTIDNVFVGTP
NLRKNKVIFVISAGETNSLDKDVLRNVSLRAKCQGYSIFVFSFGPKHNDKELEELASHPL
DHHLVQLGRTHKPDWNYITKFVKPFVHLIRRAINKYPTKDMKATCVNMTSPNPENGGTEN
TVLLLPGIYEIKTENGDLFDEFDSQAQHLLVLGNNHSNGSETATDLMHKLYLLFSTEKLA
MKDKEKAHLEEISALVVDKQQEKEDKEMEATDI
Download sequence
Identical sequences ENSGGOP00000006550 ENSGGOP00000021258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]