SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021365 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021365
Domain Number 1 Region: 385-456
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 8.37e-21
Family Intermediate filament protein, coiled coil region 0.00063
Further Details:      
 
Domain Number 2 Region: 141-175
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000194
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 3 Region: 183-253
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000141
Family Intermediate filament protein, coiled coil region 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021365
Domain Number - Region: 273-375
Classification Level Classification E-value
Superfamily Prefoldin 0.000105
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021365   Gene: ENSGGOG00000023133   Transcript: ENSGGOT00000027728
Sequence length 535
Comment pep:novel chromosome:gorGor3.1:12:50827550:50856787:-1 gene:ENSGGOG00000023133 transcript:ENSGGOT00000027728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSSVSRQTYSTKGGFSSNSASGGSGSQARTSFSSVTVSRSSGSGGGARCGPGTGGFGSR
SLYNLGGHKSISVSVAGGASSGRALGGFGFGSRAFTGQGAGRQTFGPACPPGGIQEVTVN
QSLLTPLHVEIDPEIQRVRTQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQ
GQNLGVTRNNMEPLFEAYLGSMRSTLDRLQSERGRLDSELRNVQDLVEDFKNKYEDEINK
RTAAENEFVVLKKDVDAAYMGRMDLHGKVGTLTQEIDFLQQLYEMELSQVQTHVSNTNVV
LSMDNNRNLDLDSIIAEVKAQYELIAQRSRAEAEAWYQTKYEELQVTAGKHGDNLRDTKN
EIAELTRTIQRLQGEADAAKKQCQQLQTAIAEAEQRGELALKDAQKKLGDLDVALHQAKE
DLTRLLRDYQELMNVKLALDVEIATYRKLLESEESRMSGECPSAVSISVTGNSTTVCGGG
AASFGGGISLGGSGGATKGGFSTNVAYSTVKGGPVSGGTSILRKTTTVKTSSQRY
Download sequence
Identical sequences ENSGGOP00000021365 ENSGGOP00000003797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]