SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021587 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021587
Domain Number 1 Region: 323-395
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 6.45e-23
Family Intermediate filament protein, coiled coil region 0.0005
Further Details:      
 
Domain Number 2 Region: 89-123
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000188
Family Intermediate filament protein, coiled coil region 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021587
Domain Number - Region: 126-191
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0523
Family Intermediate filament protein, coiled coil region 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021587   Gene: ENSGGOG00000023263   Transcript: ENSGGOT00000032350
Sequence length 477
Comment pep:novel chromosome:gorGor3.1:X:46361208:46362651:-1 gene:ENSGGOG00000023263 transcript:ENSGGOT00000032350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGVIQKSYKVPTSGPRAFSSCSYTSGPSAHISSSSFSRVGSSSFRDGMGGGYGGVSGM
GGITTIMVKQSLLSPLHLEVDPNIQAVHTQEKKQIKTLNKFASFINKVQFLEQQTKMLET
KWSLLQQQKMAQSNMDNMLESYINNLRRQLETLGQEKLKPEAELGMQGLVEDFKNKYEDE
INKCTEMENEFFLIKDVDEAYMNKVELESRLEGLTDQINFLRQLYEEGIRELQSQISNTS
VVLSMDNSRSLDMDSITTEIKAQYKEIANRSWAEAESMYQINYEELQTLAGKHGDDLGHT
KTEFSEMNISRNISWLQAEIGRASLEAAIADAKQRGELAVEDAKAKLSELEAALQRAKQD
MARPLREYQALMNVKLALDVEIATYRKLLEGEESRLESGMQNMSTHRKTTSGYAGGLSSA
YGGLTNPGLSYGLGSSFGSGVGSSSFSRTSFTRAVVVKKIETRDGKLVFQSSDILPK
Download sequence
Identical sequences ENSGGOP00000021587 ENSGGOP00000021587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]