SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021794 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021794
Domain Number 1 Region: 11-166
Classification Level Classification E-value
Superfamily HAD-like 5.11e-37
Family NagD-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021794   Gene: ENSGGOG00000022576   Transcript: ENSGGOT00000028157
Sequence length 171
Comment pep:novel chromosome:gorGor3.1:16:2360522:2361124:-1 gene:ENSGGOG00000022576 transcript:ENSGGOT00000028157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGPGDWLHAPLEPDVRAVVVGFDPHFSYMKLTKALRYLQQPGCLLVGTNMDNRLPLENGR
FIAGTGCLVRAVEMAAQRQADIIGKPSRFIFDCVSQEYGINPERTVMVGDRLDTDILLGV
TCGLKTILTLTGVSTLGDVKNNQESDCVSKKKMVPDFYVDSIADLLPALQG
Download sequence
Identical sequences ENSGGOP00000021794 ENSGGOP00000021794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]