SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021971 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000021971
Domain Number - Region: 796-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000718
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 228-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00455
Family Laminin-type module 0.047
Further Details:      
 
Domain Number - Region: 362-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00603
Family Laminin-type module 0.016
Further Details:      
 
Domain Number - Region: 608-740
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0108
Family Growth factor receptor domain 0.006
Further Details:      
 
Domain Number - Region: 749-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0153
Family EGF-type module 0.085
Further Details:      
 
Domain Number - Region: 189-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0168
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 446-495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0268
Family Laminin-type module 0.048
Further Details:      
 
Domain Number - Region: 142-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0572
Family Laminin-type module 0.061
Further Details:      
 
Domain Number - Region: 275-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0684
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021971   Gene: ENSGGOG00000000293   Transcript: ENSGGOT00000025594
Sequence length 1044
Comment pep:novel chromosome:gorGor3.1:15:45185071:45557758:-1 gene:ENSGGOG00000000293 transcript:ENSGGOT00000025594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSLTGLIAFSFLQATLALNPEDPNVCSHWESYAVTVQESYAHPFDQIYYTRCTDILNW
FKCTRHRISYKTAYRRGLRTMYRRRSQCCPGYYENGDFCIPLCTEECVHGRCVSPDTCHC
EPGWGGPDCSSGCDSDHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGT
HGKGCHLPCQCRHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTC
HHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDR
CQEECPFGSFGFQCSQHCDCHNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTL
PCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPCTCQNGADCHSITG
GCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPC
PSGMWGLNCNESCTCANGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSH
ADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGF
RGPLCQRICPPGFYGHGCAQPCPLCVHSSGPCHHISGICECLPGFSGALCNQVCTGGYFG
QDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHACSCHNGASCSA
EDGACHCTPGWTGLFCTQRCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGQHCE
QRCAPGTFGYGCQQLCECMNNSTCDHVTGTCYCSPGFKGIRCDQAALMMEELNPYTKISP
ALGAERHSVGAVTGIMLLLFLIVVLLGLFAWHRRRQKEKGRDLAPRVSYTPAMRMTSTDY
SLSGACGLDRRQNTYIMDKGFKDYMKESVCSSSTCSLNSSENPYATIKDPPILTCKLPES
SYVEMKSPVHMGSPYTDVPSLSTSNKNIYEVEPTVSVVQEGCGHNSSYIQNAYDLPRNSH
IPGHYDLLPVRQSPANGPSQDKQS
Download sequence
Identical sequences ENSGGOP00000000291 ENSGGOP00000021971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]