SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022025 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022025
Domain Number 1 Region: 502-799
Classification Level Classification E-value
Superfamily L domain-like 1.29e-44
Family Ngr ectodomain-like 0.0018
Further Details:      
 
Domain Number 2 Region: 69-188,220-450
Classification Level Classification E-value
Superfamily RNI-like 3.3e-41
Family Cyclin A/CDK2-associated p19, Skp2 0.057
Further Details:      
 
Domain Number 3 Region: 888-1040
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.75e-36
Family Toll/Interleukin receptor TIR domain 0.0000976
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022025   Gene: ENSGGOG00000012324   Transcript: ENSGGOT00000025620
Sequence length 1059
Comment pep:known chromosome:gorGor3.1:X:12811606:12828176:1 gene:ENSGGOG00000012324 transcript:ENSGGOT00000025620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKESSLQNSSCSLGKETKKENMFLQSSMLTCIFLLISGSCELCAEENFSRSYPCDEKKQN
DSVIAECSNRRLQEVPQTVGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQH
QNGNPGIQSNGLNITDGAFLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNIT
KEGISRLINLKNLYLAWNCYFNKVCEKTNVEDGVFETLTNLELLSLSFNSLSHVPPKLPS
SLRKLFLSNTQIKYISEEDFKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDRFA
FQNLTQLRYLNLSSTSLRKINAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPRLEIL
DLSFNYIKGSYPQHINISKNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLG
INFIKQIDFKLFQNFSNLEIIYLSENRISPLVKDTRQSYANSSSFQRHILKRRSTDFEFD
PHSNFYHFTRPLIKPQCAAYGKALDLSLNSIFFIGPNQFENLPDIACLNLSANSNAQVLS
GTEFSAIPHVKYLDLTNNRLDFDNASALTELSDLEVLDLSYNSHYFRIAGVTHHLEFIQN
FTNLKVLNLSHNNIYTLTDKYNLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLKNLT
RLDLSLNRLKHIPNEAFLNLPASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLLF
LTDSLSDFTSSLRTLLLSHNRISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTT
KLSMLELHGNPFECTCDIGDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTC
VSDVTAVILFFFTFFITTMVMLAALAHHLFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDA
YISYDTKDASVTDWVINELRYHLEESRDKNVLLCLEERDWDPGLAIIDNLMQSINQSKKT
VFVLTKKYAKSWNFKTAFYLALQRLMDENMDVIIFILLEPVLQHSQYLRLRQRICKSSIL
QWPDNPKAEGLFWQTLRNVVLTENDSRYNNMYVDSIKQY
Download sequence
Identical sequences G3R9E0
ENSGGOP00000022025 ENSGGOP00000012021 XP_004063843.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]