SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022105 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022105
Domain Number 1 Region: 20-126,315-619
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 4.71e-64
Family Integrin alpha N-terminal domain 0.0000653
Further Details:      
 
Domain Number 2 Region: 108-337
Classification Level Classification E-value
Superfamily vWA-like 1.02e-47
Family Integrin A (or I) domain 0.0000000265
Further Details:      
 
Domain Number 3 Region: 619-774
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-30
Family Integrin domains 0.0065
Further Details:      
 
Domain Number 4 Region: 776-921
Classification Level Classification E-value
Superfamily Integrin domains 2.09e-29
Family Integrin domains 0.0045
Further Details:      
 
Domain Number 5 Region: 952-1095
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000837
Family Integrin domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022105   Gene: ENSGGOG00000004075   Transcript: ENSGGOT00000024204
Sequence length 1165
Comment pep:novel chromosome:gorGor3.1:16:32035030:32165137:1 gene:ENSGGOG00000004075 transcript:ENSGGOT00000024204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITSA
NQTGGLYQCGYSTGACEPISLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHACGRNM
YLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQ
FQRPSTQFSLMQFSDKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHQLF
HASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGGQVGLAFQNRNSW
KELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSA
VFTPGGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQ
SLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLI
GAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLMD
VVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDG
LVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLGQSNICLYI
DKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLL
LPSCVEDSVTPITLRLNFTLVGKPLPAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQ
DNLGISFSFPGLKTLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPTGLSYRYVAEGQKQ
GQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTA
NVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVN
NLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNP
VLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQTLQKKVSVASVAEITFDTSV
YSQLPGQEAFMRAQMTTVLEKYKVHNPTPLIVGSSIGGLLLLALITAVLYKVGFFKRQYK
EMMEEANGQIAAENGTQTPSPPSEK
Download sequence
Identical sequences ENSGGOP00000022105 ENSGGOP00000012325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]