SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022147 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022147
Domain Number 1 Region: 201-272
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000471
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Domain Number 2 Region: 7-41
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000889
Family Intermediate filament protein, coiled coil region 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022147   Gene: ENSGGOG00000004190   Transcript: ENSGGOT00000027401
Sequence length 1580
Comment pep:novel chromosome:gorGor3.1:1:135682245:135690241:-1 gene:ENSGGOG00000004190 transcript:ENSGGOT00000027401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGCMGEESFQMWELNRRLEAYLARVKALEEQNELLSAELGGLRAQSADTSWRARADDEL
AALRALVDQRWREKHAAEVARDNLAEELEGVAGRCQQLRLARERTTEEVARNRRAVEAEK
CARARRGPPAPAPEVEELARRLGEAWRGAVRGYQERVAHMETSLGQARERLGRAVQGAAE
GRLELQQLQAERGGLQERRAALEQRLEGRWQERLRATEKFQLAVEALEQEKQGLQSQIAQ
VLEGRQQLAHLKMSLSLEVATYRTLLEAENSRLQTPGGGSKTSLSFQDPKLELQFPGTPE
GRRLGSLLPVLSPTSLPSPLPATLETPVPAFLKNQEFLQARTPTLASTPIPPTPQAPSPA
ADAEIRAQDAPLSLLQTQGGRKQAPEPLRAETRVAIPASVLPGPEEPGGQRQEASTGQSP
EDHASLAPPLSPDHSSLEAKDGESGGSRVFSICQGEGEGQIWGLVEKETAIEGKVVSSLQ
QEIWEEEDLNRKEIQDSQVPLEKETLKSLGEEIQESLKTLENQSHETLERENQECPRSLE
GDLEELKSLEKENKELLKDVEVVRPLEEEAVGQLKPTGKEDTQTLQSLQKENQELMKSLE
GNLETFLFPGKENQELVSSLQENLESLTALEKENQEPLRSPEAGDEEALRPLTKENQEPL
RSLEDENKEAFRALEKENQEPLKTLEEEDHSIVRPLETENHKSLRSLEEQDQETLRTLEK
ETQQQRRSLGEEDQMTLRPPEKVDPEPLKSLDQEIARPLENENQEFLKSLKEESVEAVKS
LETEILESLKSAGQENLETLKSPETQTPLWTPEKINQGTMKPLEKEIQEPLESVEVNQET
LRLLEEENQESLRSLGAWNLENLRSPEEVDKESQRNLEEEENLGKGEYQESLRSLEEEGQ
ELPQSADVQRWEDTVEKDQELAQESPPGMAGVENEDEAELNLREQDGVTGKEEVVEQGEL
NATEEVWIPGEGHPESPEPKEQRGLVEGASVKGGAEGLQDPEGQSQQVGAPGLQAPQGLP
EAIEPLVEDDVAPGGDQASPEVMLGSEPAMGESAAGAEPGPGQGLGGLEDPGHLTREEVM
EPPLEEESLEAKRVQGLEGPRKDLEEAGGLGTEFSELPGKSRDPWEPPKGGEESEAEAPR
GAEEAFPAETLGHTGSDAPPPWPLGSEEAEEDVPPVLVSPSPTYTPILEDAPGPQPQAEG
SQEASWGVQGRAEALGKVESEQEELGSGEIPEGLQEEGEESREESEEDELGETLPDSTPL
GFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEAPPSEKEEGEEGEEECGR
DSDLSEEFEDLGTEAPLLPGVPGEVAEPLGQVPQLLLDPAAWDRDGESDGFADEEESGEE
GEEDQEEGREPGAGRWGPGSSVGSLQALSSSQREEFLESDSVSVSVPWDDSLRGAVAGAP
KTALETESQDSAEPSGSEEESDPVSLEREDKVPGPLEIPSGMEDAGPGADIIGVNGQGPN
LEGKSQHVNGGVMNGLEQSEEVGQGMPLVSEGDRGNPFQEEEGSALKTSWAGAPVHLGQG
QFLKFTQREGDRESWSSGED
Download sequence
Identical sequences ENSGGOP00000022147 ENSGGOP00000024630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]