SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022194 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022194
Domain Number 1 Region: 36-240
Classification Level Classification E-value
Superfamily Aquaporin-like 9.42e-29
Family Aquaporin-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022194   Gene: ENSGGOG00000027009   Transcript: ENSGGOT00000025890
Sequence length 241
Comment pep:novel chromosome:gorGor3.1:2b:130134648:130137095:1 gene:ENSGGOG00000027009 transcript:ENSGGOT00000025890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLNVSLSFFFATFALCEAARRASKALLPVGAYEVFAREAVGAVQLGACCLEMRTLVEL
GPWAGDFGPDLLLTLLFLLFLAHGVTLDGASANPTVSLQEFLMAEESLPGTLLKLAAQGL
GMQAACTLTRLCWAWELSDLHLLQSLMAQSCSSALRTSVPHGALVEAACAFCFHLTLLYL
RHSPPAYSVPAVALLVTVTAYTAGPFTSAFFNPALAASVTFACSGHTLLEYVQVYWLGPL
T
Download sequence
Identical sequences ENSGGOP00000022194 ENSGGOP00000022194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]