SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022272 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022272
Domain Number 1 Region: 135-209
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000181
Family Ras-binding domain, RBD 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022272   Gene: ENSGGOG00000015265   Transcript: ENSGGOT00000030104
Sequence length 265
Comment pep:novel chromosome:gorGor3.1:1:186541802:186573965:1 gene:ENSGGOG00000015265 transcript:ENSGGOT00000030104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CKFTCHPECRSLIQLDCSQQEGLSRDRPSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQ
KIDSYNTREKNCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAAT
TDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQ
KLSIADRPLYLRLLAGPDTEVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIQ
QVQKKYDKFRQKLEEALRESQGKPG
Download sequence
Identical sequences ENSGGOP00000014895 ENSGGOP00000022272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]