SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022399 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022399
Domain Number 1 Region: 23-162
Classification Level Classification E-value
Superfamily L domain-like 6.12e-23
Family Internalin LRR domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022399   Gene: ENSGGOG00000025460   Transcript: ENSGGOT00000025409
Sequence length 624
Comment pep:novel chromosome:gorGor3.1:1:76250693:76418353:-1 gene:ENSGGOG00000025460 transcript:ENSGGOT00000025409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGTITEELTSHEEWSHYNENIREGQKDFVFVKFNGLHLKSVENLQSCISLRVCIFSNN
FITDIHPLQSCVKLIKLDLHGNQIKSLPNTKFWNGLKNLKLLYLHDNGFAKLKNICVLSA
CPTLIALTMFDCPVSLKKGYRHVLVNSIWPLKALDHHVISDEEIIQNWHLPERFKACNHR
LFFNFCPALRKGTTYEEEINNIKHITSKINAILAHNSPVLIVQRWIRGFLVRKNLSPVFF
YKKKQQEKIIRGYETKWIYITKGYEDKLLKDLFFKPETNIKGKLTYWKHNMYYPVDLKNS
GEHRKHVSSILCELKPKDLGMKSKTSRHLIQKGQESENEIVDEKLDTSFRISVFKLPIYT
SGSLKNNAVLREKKQHFFPAYPQPIYTTHPKLIIKKDIQLERSMKEFFATQRAGMKLRTF
SDIDKYYTEQKKQKCHKEKVRVVAMAQVARERVRVTVNEHLNQKKYATQKLIEENKETIQ
NSLRQVWQNRFNYLEKARERKALFLKEKSQKAAERLLVQNLNNERTLLTRGLLKIDRLKK
NEAVLKEKSLIVKQKLKAEKYGKNLLKEMKKVRSQEIYKKHCEEKFVMDMIAFEKACERL
QDAKTKVAIVKTNLDFKVPNGLIK
Download sequence
Identical sequences G3S2V1
ENSGGOP00000022399 ENSGGOP00000022399 XP_004026030.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]