SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022509 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022509
Domain Number 1 Region: 78-258
Classification Level Classification E-value
Superfamily L domain-like 1.36e-37
Family Ngr ectodomain-like 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022509   Gene: ENSGGOG00000003598   Transcript: ENSGGOT00000031426
Sequence length 316
Comment pep:novel chromosome:gorGor3.1:1:13928877:13974925:-1 gene:ENSGGOG00000003598 transcript:ENSGGOT00000031426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVPRQGSFREPLPSRRGRRGPPGHAPPSPSLRRRGARALQPSAAARARARVPRGLRLHRP
AHRGLPRGLPSVPDPFPLDVRKLLVAGNRIQRIPEDFFIFYGDLVYLDFRNNSLRSLEEG
TFSGSAKLVFLDLSYNNLTQLGAGAFRSAGRLVKLSLANNNLVGVHEDAFETLESLQVLE
LNDNNLRSLSVAALAALPALRSLRLDGNPWLCDCDFAHLFSWIQENASKLPKGLDEIQCS
LPMESRRISLRELSEASFSECRFSLSLTDLFIIIFSGVAVSIAAIISSFFLATVVQCFQR
CAPNKDAEDEDEDEDD
Download sequence
Identical sequences ENSGGOP00000022509 ENSGGOP00000003534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]