SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022591 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022591
Domain Number 1 Region: 221-295
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000000146
Family Intermediate filament protein, coiled coil region 0.0017
Further Details:      
 
Domain Number 2 Region: 1-33
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000183
Family Intermediate filament protein, coiled coil region 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022591   Gene: ENSGGOG00000026103   Transcript: ENSGGOT00000032470
Sequence length 340
Comment pep:novel chromosome:gorGor3.1:22:2790479:2791528:1 gene:ENSGGOG00000026103 transcript:ENSGGOT00000032470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NEKENMQSLNDHLASYLDRVRSLETENQRLESKNREHLEKKGPQVRDWAYFKTTEKLMAQ
IFANSVDNAFIVLHTDNAHLAAADFRVKYETELAMRQSVRSDIHGLCKVTDDTSVMKTKI
ETLKEKLLFMKNHEEGVKGLQARIASFGLTVEADVKYQDLGKIMADIWAQYDKLAQKNLE
KLDRYIEESTTVVITQSTEIRAAEITLTELRCPVQSLEIGLDLMRNLKISLENSLREVEA
CYTMQMEQLNRVLLYLESELAQTWAEGQRQAQEYEAWNIQVNLEAEITTYRRLLEDGEDF
NLGEALDSSNSMQTIQKTTTCRIVDGKVVFETNDTKVLRN
Download sequence
Identical sequences ENSGGOP00000022591 ENSGGOP00000022591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]