SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022823 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022823
Domain Number 1 Region: 502-532
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000523
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022823   Gene: ENSGGOG00000001145   Transcript: ENSGGOT00000023208
Sequence length 536
Comment pep:novel chromosome:gorGor3.1:3:118651191:118656398:1 gene:ENSGGOG00000001145 transcript:ENSGGOT00000023208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPPQEALAEPLKHESPAAPSSAGHTKGQEEDDQKNQAKRKADNHTAHRIADQTALRVP
SQAESSIFSQATNGVAEQNGHSTPGQTGRRASNPADVSDLRADDQVNQTPSEQTEGKASS
QANNVQYEQSDGQVSGLTEERTAEQTERRLPSQAERRTSGQIDGRLSMPSDQRGSRQIDH
RMSGQAERRTSEQTDHRMAGQSERRASQQTDRRLSKLSERRPSVQIDSGSSIPSDRSPSV
QIDSGSSVPSDQRPSVQIDRRMSGKVRRRSSEKTDYRLAGLADQGTSEQTDLRLYGLVDH
KTSVKTHHQVYGQATELAEHQAIDQAHSNADQPPVDNAHYTEPDQIDHLADRQANHKDQL
SYYETLGQSEDRTFPQLGNSKEDKEADYRVQPCKFEDSQVDLNSKPSVEMETQNATTIPA
YNPADARFTSNFQAKDQALFPRLPSISSKLNYTSSQEKTQAIVTKSDEFSEIEQGKGYRI
RNQTYRRFPSIVYEDPYQVSLQYMEKHHILQIFQQITEDLVYEKPEDPLNFMLCQV
Download sequence
Identical sequences ENSGGOP00000001128 ENSGGOP00000022823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]