SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022849 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022849
Domain Number 1 Region: 58-277
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 8.64e-87
Family Fibrinogen C-terminal domain-like 0.00000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022849   Gene: ENSGGOG00000006049   Transcript: ENSGGOT00000028178
Sequence length 278
Comment pep:novel chromosome:gorGor3.1:5:60293504:60297228:1 gene:ENSGGOG00000006049 transcript:ENSGGOT00000028178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGELSPLQRPLATEGTMKAQVLLKLALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQ
PLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWN
DYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAE
EDGYTLFVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANL
NGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA
Download sequence
Identical sequences G3QTA7
ENSGGOP00000005920 ENSGGOP00000022849 XP_004042182.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]