SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023032 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023032
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000811
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023032   Gene: ENSGGOG00000006062   Transcript: ENSGGOT00000024242
Sequence length 489
Comment pep:known chromosome:gorGor3.1:18:21149451:21172107:1 gene:ENSGGOG00000006062 transcript:ENSGGOT00000024242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFTAAYFQELTMYRGNTTMDIKDLVK
QFHQIKVEKWSEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTT
QFPSVYAVPGTEQMEAVGDLSSKPATPKTTTTTPPSSPPPTAVSPEFAYVPADPAQLAAH
MLGKVSSIHSDQSDVLMVDVATSMPVVIKEVPSSEAAEDVMVAAPLVCSGKVLEVQVVNQ
TSVHVDLGSQPKENEAEPSTASSAPLQDEQEPPAYDQAPEVTLQADIEVMSTVHISSVYN
DVPVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSPRVSPKSVVEKTTSGMSKKSVESVK
LAQLEENAKYSSVYMEAEATALLSDTSLKGQPEVPAQLLDAEGAIKIGSEKSLYLEVEIT
SIVSDNTGQEESGENSVPQEMEGKPVLSGEAAEAVHSGTSVKSSSGPFPPAPEGLTAPEI
EPEGEATAE
Download sequence
Identical sequences ENSGGOP00000005928 ENSGGOP00000023032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]