SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023037 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023037
Domain Number 1 Region: 1-75
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000626
Family Ubiquitin-related 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023037   Gene: ENSGGOG00000026136   Transcript: ENSGGOT00000025913
Sequence length 128
Comment pep:novel chromosome:gorGor3.1:3:182485557:182486102:-1 gene:ENSGGOG00000026136 transcript:ENSGGOT00000025913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLFVRAQELHSLEMTGQEAAAQIKAHVASLKGTAWEDQPVLLASTPLKDETTLGEYSVE
ALITLEVAIHMLRGKVHVSLAHSGKVRGQTLTVAKLMTGRVKWWIQYNQRIVNVVPTFGK
KKVPNPTL
Download sequence
Identical sequences ENSGGOP00000023037 ENSGGOP00000023037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]