SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023071 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023071
Domain Number 1 Region: 229-283
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000108
Family Intermediate filament protein, coiled coil region 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023071
Domain Number - Region: 9-43
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000371
Family Intermediate filament protein, coiled coil region 0.0048
Further Details:      
 
Domain Number - Region: 44-112
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0356
Family Intermediate filament protein, coiled coil region 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023071   Gene: ENSGGOG00000023223   Transcript: ENSGGOT00000025468
Sequence length 360
Comment pep:novel chromosome:gorGor3.1:1:183890645:183892006:-1 gene:ENSGGOG00000023223 transcript:ENSGGOT00000025468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNIQAMCTQEKEQIKTLDSKCACITDTIQLLEQQNKMLQSKCQQKTAQSNMDNMLESYIN
NLQQQLYILGQEQLKLEAELGNMEGLLEDFKNKREDEINKCTEMDNEFVFIKKFTDKAYM
KNVELESCMEGLTDEINFIRQLYEEEIQELQSQILDTSVVLSMDNSHSTDTDSITTEVKD
QYEIANHSGQAENTYQIKYEELQTLAGKHEDDVRTKTKISEMNQNISWLQAETESLKGQK
TSLEAAITNAKQRGSRHELRNVKLALDTEVATYMKLLKGNKSRLESGMQNISIYIKTTNS
CSGALSLAYGASQALASSMGALAPSAPPASPGFLQVPWLLKKIETRDGKLVSKSSDVLPK
Download sequence
Identical sequences ENSGGOP00000023071 ENSGGOP00000023071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]