SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023160 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000023160
Domain Number - Region: 79-112
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00178
Family Intermediate filament protein, coiled coil region 0.0056
Further Details:      
 
Domain Number - Region: 190-228
Classification Level Classification E-value
Superfamily F1 ATPase inhibitor, IF1, C-terminal domain 0.0194
Family F1 ATPase inhibitor, IF1, C-terminal domain 0.0096
Further Details:      
 
Domain Number - Region: 115-256
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0432
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023160   Gene: ENSGGOG00000022037   Transcript: ENSGGOT00000027623
Sequence length 327
Comment pep:novel chromosome:gorGor3.1:20:23332595:23333588:-1 gene:ENSGGOG00000022037 transcript:ENSGGOT00000027623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFTTRSTFSTNYWSLGSVQTPSYGAQLISSKASVYEGAGASGSLISMSHSTSFWGGMVS
RALAVGMAGSLAGIEGIQNKKETRQSLNDHLISYLDRVRSPATMNQRLESKICEQLEKKG
PQVRDWGHYFKTIEDLRAQIFANTVGNAHIVLQIDNAHLAADDFRVKYETELAMIQSVES
DLHGLCKVIDDTNVTRLQLEQIKALKEELLFMKKNHKEEIKGLQAQITSSGLTVEVDAPK
SQDLNYIQAQYDELVQKNRGELDKYWSQQIKESTTVVTTQSTDVGAAEMMLTELRHTVQS
LEIDLDSIRNLKASLENSLREVEAPYT
Download sequence
Identical sequences ENSGGOP00000023160 ENSGGOP00000023160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]