SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023203 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000023203
Domain Number - Region: 53-149
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0348
Family Ubiquitin carboxyl-terminal hydrolase UCH-L 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023203   Gene: ENSGGOG00000027200   Transcript: ENSGGOT00000027472
Sequence length 169
Comment pep:novel chromosome:gorGor3.1:7:26882494:26889874:1 gene:ENSGGOG00000027200 transcript:ENSGGOT00000027472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSCGWALTQSDWCPFKKRKSHQRCAHSETRHMRTQRQGGYLQARERGLGEANPAYALIL
DFQPPELQNLSEMGINHELGYSSIIPMMKRALSACGTLGLIMSGVFDNPGPIKNTLKKAF
TMLWSFTIYTRLESLRVALSNEEMVPFIFRPKTQTANMLSGPISTPMLL
Download sequence
Identical sequences ENSGGOP00000023203 ENSGGOP00000023203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]