SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023259 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023259
Domain Number 1 Region: 10-225
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.45e-43
Family G proteins 0.00000156
Further Details:      
 
Domain Number 2 Region: 303-404
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.93e-41
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000544
Further Details:      
 
Domain Number 3 Region: 227-337
Classification Level Classification E-value
Superfamily Translation proteins 1.27e-19
Family Elongation factors 0.000077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023259   Gene: ENSGGOG00000025926   Transcript: ENSGGOT00000031196
Sequence length 427
Comment pep:novel chromosome:gorGor3.1:12:17197962:17199359:1 gene:ENSGGOG00000025926 transcript:ENSGGOT00000031196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLPLKAKMGKEKTNINIVITGQVGSGKSTTTGHLIYKCIDVDKRTIQKFEKEAADGKGLL
QFDTSKYYVSIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTHEHAL
LAYTLGVKQLIVGVNKMDSTEQPYSQKIHEEIVKEVNTYIMKSGCNLDTAAFVLISGPSA
NMPWFKGLKVTRKDGNTSGTSLLEALDCILPPTHPTNKPFHLLLMSTKIGGIGTVSVGCS
QTLYGAPVNVTTEVKSVEIHHEALSEALPGDNVGFNVKNVSVKDVRHGNNAGDSKNDPPM
EAAGFTAQVIILNHPGQISAGYAPVLDCHTAHTACKFAELKEKIDRCSGKKLEDGPKFLK
SGDAAIIYMVPGKPMCVESFSDYPPLGHFAVGHMRQTVAMGIIKAEDRKAAGVGKVTKSA
QKAPKPS
Download sequence
Identical sequences ENSGGOP00000023259 ENSGGOP00000023259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]