SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023318 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023318
Domain Number 1 Region: 2-202
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6e-33
Family G proteins 0.00000236
Further Details:      
 
Domain Number 2 Region: 268-368
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 4.1e-24
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000441
Further Details:      
 
Domain Number 3 Region: 184-264
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000000641
Family Elongation factors 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023318   Gene: ENSGGOG00000026628   Transcript: ENSGGOT00000028435
Sequence length 389
Comment pep:novel chromosome:gorGor3.1:1:24479781:24489698:1 gene:ENSGGOG00000026628 transcript:ENSGGOT00000028435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMGKGSFTYSWVLDKLKAGWKFWTKQYYVTIIDAMGHCDFIKNMITGTCQEDCAVLIVAS
GVGECEAGISKNKQICEHTLLAYTLGMKQLIVTVNKMDITEPPYSSTCFEEISKEVNAYI
KKISYNSQTVPFVPISGWHGDNMLEPGSKMPWFEGCKVTRKEWNVAGVTLLKALDSITAT
HSTDKPLQLPLTGRYKTGGIGTVLVGQVEAGMVVTFAPCNITMEVESVEMHKALPGDKVG
FHMKNVSVKDIRRGDLADSKNDPPSEVASFVSQVIILNYLGCTTAGYSPVLYRHTAHIAC
MFAESKFANQRLGKKVEDNPRALKSGDLAIAQMILGKPMCVESFSDYPPLKKVISLCDMK
QTVAVGAIKIGEKSSYWQQGHQGSQEGSQ
Download sequence
Identical sequences ENSGGOP00000023318 ENSGGOP00000023318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]