SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023390 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023390
Domain Number 1 Region: 335-412
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 7.15e-21
Family Intermediate filament protein, coiled coil region 0.00059
Further Details:      
 
Domain Number 2 Region: 105-139
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000033
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023390
Domain Number - Region: 229-335
Classification Level Classification E-value
Superfamily Prefoldin 0.000471
Family Prefoldin 0.01
Further Details:      
 
Domain Number - Region: 143-213
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000575
Family Intermediate filament protein, coiled coil region 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023390   Gene: ENSGGOG00000016301   Transcript: ENSGGOT00000027035
Sequence length 505
Comment pep:novel chromosome:gorGor3.1:12:50318140:50329056:1 gene:ENSGGOG00000016301 transcript:ENSGGOT00000027035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCGSYCGGRAFSCISACGPRPGRCCITAAPYRGISCYRGLTGGFGSHSVCGGFRAGSCG
RSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAF
IDKVRFLEQQNKLLETKLQFYQNRECCQSNLEPLFEGYIETLRREAECVEADSGRLASEL
NHVQEVLEGYKKKYEEEVSLRATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLR
RLYDEEIRILQSHISDTSVVVKLDNSRDLNMDCIIAEIKAQYDDIVTRSRAEAESWYRSK
CEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVAQSEQQGEAA
LSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEG
IGAVNVCVSSSRGGVVCGDLCVSGSRPVTGSVCSAPCNGNVAVSTGLCAPCGQLNTTCGG
GSCGVGSCGISSLGVGSCGSSCRKC
Download sequence
Identical sequences A0A2I2YSB4
ENSGGOP00000015906 ENSGGOP00000023390 XP_018893534.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]