SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023560 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023560
Domain Number 1 Region: 117-203
Classification Level Classification E-value
Superfamily SH2 domain 4.53e-47
Family SH2 domain 0.0000132
Further Details:      
 
Domain Number 2 Region: 209-287
Classification Level Classification E-value
Superfamily RING/U-box 8.73e-41
Family RING finger domain, C3HC4 0.00012
Further Details:      
 
Domain Number 3 Region: 31-116
Classification Level Classification E-value
Superfamily EF-hand 6.58e-39
Family EF-hand modules in multidomain proteins 0.00013
Further Details:      
 
Domain Number 4 Region: 1-30
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 0.00000000000523
Family N-terminal domain of cbl (N-cbl) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023560   Gene: ENSGGOG00000025562   Transcript: ENSGGOT00000033241
Sequence length 357
Comment pep:novel chromosome:gorGor3.1:19:41989199:42010201:1 gene:ENSGGOG00000025562 transcript:ENSGGOT00000033241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRQLAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFES
LLGTCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPG
YMAFLTYDEVQERLQAYRDKPGSYIFRPSCTRLGQWAIGYVSSDGSVLQTIPANKPLSQV
LLEGQKDGFYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFELCKICAES
NKDVKIEPCGHLLCSRCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGDSS
DQEGRELELGQVPLSAPPLPPRPDLPPRKPRNAQPEVRLLKGNSPPAALGPQDPAPA
Download sequence
Identical sequences ENSGGOP00000023560 ENSGGOP00000023560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]