SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023590 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023590
Domain Number 1 Region: 18-106
Classification Level Classification E-value
Superfamily Prefoldin 0.000000222
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023590   Gene: ENSGGOG00000024924   Transcript: ENSGGOT00000028230
Sequence length 133
Comment pep:novel chromosome:gorGor3.1:20:29249440:29256622:-1 gene:ENSGGOG00000024924 transcript:ENSGGOT00000028230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVC
FGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLN
QDELKALKVILKG
Download sequence
Identical sequences A0A096NUZ7 A0A2J8VIL3 A0A2K5NSK5 A0A2K5ZWQ4 A0A2K6ASZ5 F6SXT9 G3S683 G7PGN4 Q9NUG6
9544.ENSMMUP00000001307 9606.ENSP00000202017 ENSGGOP00000023590 NP_001252911.1.72884 NP_110442.1.87134 NP_110442.1.92137 XP_004062007.1.27298 XP_005568705.1.63531 XP_011764625.1.29376 XP_011835179.1.47321 XP_011907855.1.92194 gi|18079254|ref|NP_110442.1| ENSMMUP00000001307 ENSPANP00000016872 ENSMMUP00000001307 ENSP00000202017 ENSGGOP00000023590 GO.39908 ENSP00000202017 ENSP00000202017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]