SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023681 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023681
Domain Number 1 Region: 129-377
Classification Level Classification E-value
Superfamily vWA-like 7.78e-82
Family Integrin A (or I) domain 0.0000000228
Further Details:      
 
Domain Number 2 Region: 373-462
Classification Level Classification E-value
Superfamily Integrin domains 2.62e-30
Family Integrin domains 0.0001
Further Details:      
 
Domain Number 3 Region: 629-711
Classification Level Classification E-value
Superfamily Integrin beta tail domain 9.02e-19
Family Integrin beta tail domain 0.00033
Further Details:      
 
Domain Number 4 Region: 22-74
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000382
Family Plexin repeat 0.00077
Further Details:      
 
Domain Number 5 Region: 588-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000106
Family Integrin beta EGF-like domains 0.0032
Further Details:      
 
Domain Number 6 Region: 545-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023681
Domain Number - Region: 514-545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0391
Family Integrin beta EGF-like domains 0.031
Further Details:      
 
Domain Number - Region: 470-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0614
Family Integrin beta EGF-like domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023681   Gene: ENSGGOG00000011869   Transcript: ENSGGOT00000029073
Sequence length 795
Comment pep:novel chromosome:gorGor3.1:3:124455290:124566381:-1 gene:ENSGGOG00000011869 transcript:ENSGGOT00000029073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIHEVYSQELISASLSCFKGLNICTGGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRC
DLRANLVRNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKT
TFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFGSFVD
KDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRD
APEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNE
ANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILDGDS
KNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGDTASF
EVSVEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCSGSGTYVC
GLCECSPGYLGTRCECQDGENQSVYQNLCREAEGKPLCSGRGDCSCNQCSCFESEFGKIY
GPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQICSE
RGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSLCRDE
VITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVLREPECGNTPNAMTIL
LAVVGSILLVGLALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPISTHTVD
FTFSKFNKSYNGTVD
Download sequence
Identical sequences ENSGGOP00000023681 ENSGGOP00000023681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]