SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023691 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023691
Domain Number 1 Region: 55-128
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000000136
Family Intermediate filament protein, coiled coil region 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023691   Gene: ENSGGOG00000014873   Transcript: ENSGGOT00000030947
Sequence length 1376
Comment pep:novel chromosome:gorGor3.1:15:79158891:79189683:1 gene:ENSGGOG00000014873 transcript:ENSGGOT00000030947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVAESWRETVQLYEDEVRELEEALRRGQESRLQAEEETRLCAQEAEALRREALGLEQLRA
RLEDALLRMREEYGIQAEERQRAIDCLEDEKATLTLAMADWLRDYQDLLQVKTGLSLEVA
TYRALLEGESNPEIVIWAEHVENMPSEFRNKSYHYTDSLLQRENERNLFSRQKAPLASFN
HSSALYSNLSGHRRSQTGTSIGGDARRGFLGSGYSSSATTQQENSYGKAVSSQTNVRTFS
PTYGLLRNTEAQVKTFPDRPKAGDTREVPVYIGEDSTIARESYRDRRDKVAAGASESTRS
NERTVILGKKTEVKATREQERNRPETIRTKPEEKMFDSKEKASEERNLRWEELTKLDKEA
RQRESQQMKEKAKEKDSPKEKSVREREVPISLEVSQDRRAEVSPKGLQTPVKDAGGGTGR
EAEARELRFRLGTSDAAGSLQGDSMTETVAENIVTSILKQFTQSPETEASADSFPDTKVT
YVDRKELPGERKTKTEIVVESKLTEDVDVSDEAGLDYLLSKDMREVGLKGKSAEQVIGDI
INLGLKGREGRAKVVNVEIVEEPVSYVSGEKPEEFSVPFKVEEVEDVSPGPSGLVKEEEG
YGESDVTFSVNQHQRTKQPQENTTHVEEVTEAGDSEGEQSYFVSTPDEHPGGHDRDDGSV
YGQIHIEEESTIRYSWQDEIVQGTRRRTQKDGAVGEKVVKPLDVPAPSLEGDLGSTHWKE
QARSGEFHAEPTVIEKEIKIPHEFHTSMKGISSKEPRQQLVEVIGQLEETLPERMREELS
ALTREGQGGPGSVSVDVKKVQGAGGSSVTLVAEVNVSQTVDADRLDLEELSKDEASEMEK
AVESVVRESLSRQRSPAPGSPDEEGGAGAPAAGVRFRRWATRELYIPSGESEVAGGASHS
SGQRTPRGPVSATVEVSSPTGFAQSQVLEDVSQAARHIKLGPSEVWRTERMSYEGPTAEV
VEVSAGGDLSQAASPTGASRSVRHVTLGPGQSPLSREVIFLGPAPACPEAGGSPEPGPAE
SSADTDGSGRHSTFGCRQFHAEKEIIFQGPISAAGKVGDYFATEESVGTQTSVRQLQLGP
KEGFSGQIQFTAPLSDKVELGVRGDSVHMEGLPGSSTSIRHISIGPQRHQTTQQIVYHGL
VPEPGESGDSESTVHGEGSADLHQATHSHTSGRQTVMTEKSTFQSVVSESPQEDSAGDTS
GAEMTSGVSRSFRHIRLGPTETETSEHVAIRGPVSRTFVLAGSADSPELGKLADSSRTLR
HIAPGPKETSFTFQMDVSNVEAIRSRTQEAGALGVSDRGSWRDADSRNDQAVGVSFKASA
GEGDQAHGEQGKEQAMFDKKVQLQRMVDQRSVISDEKKIALLYLDNEEEENDGHWF
Download sequence
Identical sequences ENSGGOP00000023691 ENSGGOP00000014514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]